General Information

  • ID:  hor007297
  • Uniprot ID:  Q9VT53??28-134)
  • Protein name:  Probable insulin-like peptide 4
  • Gene name:  NA
  • Organism:  Drosophila melanogaster
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Expressed at a high level in the embryonic mesoderm; with expression continuing after gastrulation and reducing from stage 12 onwards. Highly expressed in the embryonic anterior midgut rudiment and la
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0005158 insulin receptor binding; GO:0005179 hormone activity; GO:0001664 G protein-coupled receptor binding
  • GO CC:  GO:0008286 insulin receptor signaling pathway; GO:0030536 larval feeding behavior; GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway

Sequence Information

  • Sequence:  RKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQQPDEDIEQETETGRLKQKHTDADTEKGVPPAVGSGRKLRRHRRRIAHECCKEGCTYDDILDYCA
  • Length:  107
  • Propeptide:  MSLIRLGLALLLLLATVSQLLQPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQQPDEDIEQETETGRLKQKHTDADTEKGVPPAVGSGRKLRRHRRRIAHECCKEGCTYDDILDYCA
  • Signal peptide:  MSLIRLGLALLLLLATVSQLLQPVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA